PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g77020.1.p
Common NameBRADI_1g77020, LOC100841167
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 259aa    MW: 29272.3 Da    PI: 9.1167
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g77020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.91.1e-272777151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien   rqvtfskRr g+ KKA+ELSvLCd+eva+i+fs++g+lye++s
  Bradi1g77020.1.p 27 KRIENRASRQVTFSKRRGGLRKKAHELSVLCDVEVALIVFSPSGRLYEFAS 77
                      79***********************************************86 PP

2K-box64.15.1e-2295189598
             K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       +++ +++++ e+ + +++ L +++e L+   R++lGe+Le ++s++eL++Le ++eksl++iR  K++++ +q+ +l++ke  l++en++Lr 
  Bradi1g77020.1.p  95 TSSPTAQQDIEKIKADAEGLSQKLEALEAYRRKFLGEKLEdDCSFEELNSLEVKMEKSLRSIRRMKTQVFEDQLAKLRQKEMTLRKENEDLRG 187
                       3333789999*****************************746**************************************************9 PP

             K-box  97 kl 98 
                       k+
  Bradi1g77020.1.p 188 KV 189
                       87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.3331979IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-361978IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-282141IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-312194IPR002100Transcription factor, MADS-box
CDDcd002657.33E-382188No hitNo description
PROSITE patternPS0035002175IPR002100Transcription factor, MADS-box
PfamPF003192.1E-262875IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-284156IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-285677IPR002100Transcription factor, MADS-box
PfamPF014861.3E-23101189IPR002487Transcription factor, K-box
PROSITE profilePS5129712.357104195IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MQAGRLDRRG SIWDRSTKMV RGKTQLKRIE NRASRQVTFS KRRGGLRKKA HELSVLCDVE  60
VALIVFSPSG RLYEFASASM QKTLERYKAS TKDKTSSPTA QQDIEKIKAD AEGLSQKLEA  120
LEAYRRKFLG EKLEDDCSFE ELNSLEVKME KSLRSIRRMK TQVFEDQLAK LRQKEMTLRK  180
ENEDLRGKVT KGSENEDLQA KCKDVVDLTL VTSAPMIAAA AAAEEEEENP PEAQPELNKD  240
AMDVETELFI GLPGRNRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-202189270Myocyte-specific enhancer factor 2A
3mu6_B2e-202189270Myocyte-specific enhancer factor 2A
3mu6_C2e-202189270Myocyte-specific enhancer factor 2A
3mu6_D2e-202189270Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693080.0KF469308.1 Brachypodium distachyon MADS-box transcription factor 13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289808.10.0MADS-box transcription factor 50-like
SwissprotQ9XJ601e-92MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLI1HAD00.0I1HAD0_BRADI; MADS-box transcription factor 13
STRINGBRADI1G77020.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-61AGAMOUS-like 20
Publications ? help Back to Top
  1. Wei B, et al.
    Genome-wide analysis of the MADS-box gene family in Brachypodium distachyon.
    PLoS ONE, 2014. 9(1): p. e84781
    [PMID:24454749]